Anti NUMBL pAb (ATL-HPA058380)

Atlas Antibodies

Catalog No.:
ATL-HPA058380-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: numb homolog (Drosophila)-like
Gene Name: NUMBL
Alternative Gene Name: CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063160: 96%, ENSRNOG00000020867: 94%
Entrez Gene ID: 9253
Uniprot ID: Q9Y6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP
Gene Sequence NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP
Gene ID - Mouse ENSMUSG00000063160
Gene ID - Rat ENSRNOG00000020867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUMBL pAb (ATL-HPA058380)
Datasheet Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link)
Vendor Page Anti NUMBL pAb (ATL-HPA058380) at Atlas Antibodies

Documents & Links for Anti NUMBL pAb (ATL-HPA058380)
Datasheet Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link)
Vendor Page Anti NUMBL pAb (ATL-HPA058380)