Anti NUMBL pAb (ATL-HPA058380)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058380-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NUMBL
Alternative Gene Name: CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063160: 96%, ENSRNOG00000020867: 94%
Entrez Gene ID: 9253
Uniprot ID: Q9Y6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP |
Gene Sequence | NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP |
Gene ID - Mouse | ENSMUSG00000063160 |
Gene ID - Rat | ENSRNOG00000020867 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUMBL pAb (ATL-HPA058380) | |
Datasheet | Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link) |
Vendor Page | Anti NUMBL pAb (ATL-HPA058380) at Atlas Antibodies |
Documents & Links for Anti NUMBL pAb (ATL-HPA058380) | |
Datasheet | Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link) |
Vendor Page | Anti NUMBL pAb (ATL-HPA058380) |