Anti NUFIP2 pAb (ATL-HPA067443)

Atlas Antibodies

SKU:
ATL-HPA067443-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear fragile X mental retardation protein interacting protein 2
Gene Name: NUFIP2
Alternative Gene Name: 182-FIP, 82-FIP, FIP-82, KIAA1321, MGC117262, PIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037857: 92%, ENSRNOG00000024964: 93%
Entrez Gene ID: 57532
Uniprot ID: Q7Z417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG
Gene Sequence NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG
Gene ID - Mouse ENSMUSG00000037857
Gene ID - Rat ENSRNOG00000024964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUFIP2 pAb (ATL-HPA067443)
Datasheet Anti NUFIP2 pAb (ATL-HPA067443) Datasheet (External Link)
Vendor Page Anti NUFIP2 pAb (ATL-HPA067443) at Atlas Antibodies

Documents & Links for Anti NUFIP2 pAb (ATL-HPA067443)
Datasheet Anti NUFIP2 pAb (ATL-HPA067443) Datasheet (External Link)
Vendor Page Anti NUFIP2 pAb (ATL-HPA067443)