Anti NUF2 pAb (ATL-HPA076604)

Atlas Antibodies

Catalog No.:
ATL-HPA076604-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NUF2, NDC80 kinetochore complex component
Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 85%, ENSRNOG00000002711: 85%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE
Gene Sequence YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE
Gene ID - Mouse ENSMUSG00000026683
Gene ID - Rat ENSRNOG00000002711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUF2 pAb (ATL-HPA076604)
Datasheet Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link)
Vendor Page Anti NUF2 pAb (ATL-HPA076604) at Atlas Antibodies

Documents & Links for Anti NUF2 pAb (ATL-HPA076604)
Datasheet Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link)
Vendor Page Anti NUF2 pAb (ATL-HPA076604)
Citations for Anti NUF2 pAb (ATL-HPA076604) – 1 Found
Jiang, Xiaodan; Jiang, Yan; Luo, Senbiao; Sekar, Karthik; Koh, Clara Kai Ting; Deivasigamani, Amudha; Dong, Qingzhe; Zhang, Niankai; Li, Shenling; Hao, Fengyun; Goh, Brian Kim Poh; Ooi, London Lucien; Wang, Yu; Hui, Kam Man. Correlation of NUF2 Overexpression with Poorer Patient Survival in Multiple Cancers. Cancer Research And Treatment. 2021;53(4):944-961.  PubMed