Anti NUF2 pAb (ATL-HPA076604)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA076604-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $447.00
    
         
                            Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 85%, ENSRNOG00000002711: 85%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE | 
| Gene Sequence | YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE | 
| Gene ID - Mouse | ENSMUSG00000026683 | 
| Gene ID - Rat | ENSRNOG00000002711 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti NUF2 pAb (ATL-HPA076604) | |
| Datasheet | Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link) | 
| Vendor Page | Anti NUF2 pAb (ATL-HPA076604) at Atlas Antibodies | 
| Documents & Links for Anti NUF2 pAb (ATL-HPA076604) | |
| Datasheet | Anti NUF2 pAb (ATL-HPA076604) Datasheet (External Link) | 
| Vendor Page | Anti NUF2 pAb (ATL-HPA076604) | 
| Citations for Anti NUF2 pAb (ATL-HPA076604) – 1 Found | 
| Jiang, Xiaodan; Jiang, Yan; Luo, Senbiao; Sekar, Karthik; Koh, Clara Kai Ting; Deivasigamani, Amudha; Dong, Qingzhe; Zhang, Niankai; Li, Shenling; Hao, Fengyun; Goh, Brian Kim Poh; Ooi, London Lucien; Wang, Yu; Hui, Kam Man. Correlation of NUF2 Overexpression with Poorer Patient Survival in Multiple Cancers. Cancer Research And Treatment. 2021;53(4):944-961. PubMed |