Anti NUDT5 pAb (ATL-HPA019827)

Atlas Antibodies

Catalog No.: ATL-HPA019827-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 5
Gene Name: NUDT5
Alternative Gene Name: hYSAH1, YSA1H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025817: 87%, ENSRNOG00000017741: 90%
Entrez Gene ID: 11164
Uniprot ID: Q9UKK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
• Gene Sequence: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
• Gene ID - Mouse: ENSMUSG00000025817
• Gene ID - Rat: ENSRNOG00000017741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.