Anti NUDT22 pAb (ATL-HPA053464)

Atlas Antibodies

Catalog No.:
ATL-HPA053464-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 22
Gene Name: NUDT22
Alternative Gene Name: MGC13045
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037349: 79%, ENSRNOG00000021158: 77%
Entrez Gene ID: 84304
Uniprot ID: Q9BRQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLT
Gene Sequence DPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLT
Gene ID - Mouse ENSMUSG00000037349
Gene ID - Rat ENSRNOG00000021158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDT22 pAb (ATL-HPA053464)
Datasheet Anti NUDT22 pAb (ATL-HPA053464) Datasheet (External Link)
Vendor Page Anti NUDT22 pAb (ATL-HPA053464) at Atlas Antibodies

Documents & Links for Anti NUDT22 pAb (ATL-HPA053464)
Datasheet Anti NUDT22 pAb (ATL-HPA053464) Datasheet (External Link)
Vendor Page Anti NUDT22 pAb (ATL-HPA053464)