Anti NUDT21 pAb (ATL-HPA074228)

Atlas Antibodies

SKU:
ATL-HPA074228-100
  • Immunofluorescent staining of human cell line PC-3 shows localization to nuclear bodies.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 21
Gene Name: NUDT21
Alternative Gene Name: CFIM25, CPSF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031754: 100%, ENSRNOG00000042983: 100%
Entrez Gene ID: 11051
Uniprot ID: O43809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG
Gene Sequence GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG
Gene ID - Mouse ENSMUSG00000031754
Gene ID - Rat ENSRNOG00000042983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUDT21 pAb (ATL-HPA074228)
Datasheet Anti NUDT21 pAb (ATL-HPA074228) Datasheet (External Link)
Vendor Page Anti NUDT21 pAb (ATL-HPA074228) at Atlas Antibodies

Documents & Links for Anti NUDT21 pAb (ATL-HPA074228)
Datasheet Anti NUDT21 pAb (ATL-HPA074228) Datasheet (External Link)
Vendor Page Anti NUDT21 pAb (ATL-HPA074228)