Anti NUDT2 pAb (ATL-HPA058623)
Atlas Antibodies
- SKU:
- ATL-HPA058623-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NUDT2
Alternative Gene Name: APAH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028443: 89%, ENSRNOG00000013110: 91%
Entrez Gene ID: 318
Uniprot ID: P50583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
Gene Sequence | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
Gene ID - Mouse | ENSMUSG00000028443 |
Gene ID - Rat | ENSRNOG00000013110 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUDT2 pAb (ATL-HPA058623) | |
Datasheet | Anti NUDT2 pAb (ATL-HPA058623) Datasheet (External Link) |
Vendor Page | Anti NUDT2 pAb (ATL-HPA058623) at Atlas Antibodies |
Documents & Links for Anti NUDT2 pAb (ATL-HPA058623) | |
Datasheet | Anti NUDT2 pAb (ATL-HPA058623) Datasheet (External Link) |
Vendor Page | Anti NUDT2 pAb (ATL-HPA058623) |