Anti NUDT18 pAb (ATL-HPA030125)

Atlas Antibodies

Catalog No.: ATL-HPA030125-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 18
Gene Name: NUDT18
Alternative Gene Name: FLJ22494, MTH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045211: 79%, ENSRNOG00000011831: 83%
Entrez Gene ID: 79873
Uniprot ID: Q6ZVK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVN
• Gene Sequence: LTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVN
• Gene ID - Mouse: ENSMUSG00000045211
• Gene ID - Rat: ENSRNOG00000011831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.