Anti NUDT17 pAb (ATL-HPA030145 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030145-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 17
Gene Name: NUDT17
Alternative Gene Name: FLJ34433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028100: 79%, ENSRNOG00000037217: 78%
Entrez Gene ID: 200035
Uniprot ID: P0C025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSV
• Gene Sequence: RLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSV
• Gene ID - Mouse: ENSMUSG00000028100
• Gene ID - Rat: ENSRNOG00000037217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.