Anti NUDT1 pAb (ATL-HPA012636 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012636-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 1
Gene Name: NUDT1
Alternative Gene Name: MTH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036639: 81%, ENSRNOG00000001260: 83%
Entrez Gene ID: 4521
Uniprot ID: P36639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL
• Gene Sequence: RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL
• Gene ID - Mouse: ENSMUSG00000036639
• Gene ID - Rat: ENSRNOG00000001260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NUDT1 pAb (ATL-HPA012636 w/enhanced validation) – 1 Found

van der Waals, Lizet M; Laoukili, Jamila; Jongen, Jennifer M J; Raats, Danielle A; Borel Rinkes, Inne H M; Kranenburg, Onno. Differential anti-tumour effects of MTH1 inhibitors in patient-derived 3D colorectal cancer cultures. Scientific Reports. 2019;9(1):819.