Anti NUDCD2 pAb (ATL-HPA037385)

Atlas Antibodies

Catalog No.: ATL-HPA037385-25

Protein Description: NudC domain containing 2
Gene Name: NUDCD2
Alternative Gene Name: DKFZp686E10109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020328: 98%, ENSRNOG00000060914: 96%
Entrez Gene ID: 134492
Uniprot ID: Q8WVJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSV
• Gene Sequence: PFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSV
• Gene ID - Mouse: ENSMUSG00000020328
• Gene ID - Rat: ENSRNOG00000060914
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NUDCD2 pAb (ATL-HPA037385) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.