Anti NUDCD1 pAb (ATL-HPA023183)

Atlas Antibodies

Catalog No.:
ATL-HPA023183-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NudC domain containing 1
Gene Name: NUDCD1
Alternative Gene Name: CML66, FLJ14991
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038736: 93%, ENSRNOG00000024929: 96%
Entrez Gene ID: 84955
Uniprot ID: Q96RS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Gene Sequence IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Gene ID - Mouse ENSMUSG00000038736
Gene ID - Rat ENSRNOG00000024929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDCD1 pAb (ATL-HPA023183)
Datasheet Anti NUDCD1 pAb (ATL-HPA023183) Datasheet (External Link)
Vendor Page Anti NUDCD1 pAb (ATL-HPA023183) at Atlas Antibodies

Documents & Links for Anti NUDCD1 pAb (ATL-HPA023183)
Datasheet Anti NUDCD1 pAb (ATL-HPA023183) Datasheet (External Link)
Vendor Page Anti NUDCD1 pAb (ATL-HPA023183)