Anti NUCKS1 pAb (ATL-HPA062351)

Atlas Antibodies

Catalog No.:
ATL-HPA062351-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear casein kinase and cyclin-dependent kinase substrate 1
Gene Name: NUCKS1
Alternative Gene Name: NUCKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026434: 98%, ENSRNOG00000047287: 100%
Entrez Gene ID: 64710
Uniprot ID: Q9H1E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG
Gene Sequence MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG
Gene ID - Mouse ENSMUSG00000026434
Gene ID - Rat ENSRNOG00000047287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUCKS1 pAb (ATL-HPA062351)
Datasheet Anti NUCKS1 pAb (ATL-HPA062351) Datasheet (External Link)
Vendor Page Anti NUCKS1 pAb (ATL-HPA062351) at Atlas Antibodies

Documents & Links for Anti NUCKS1 pAb (ATL-HPA062351)
Datasheet Anti NUCKS1 pAb (ATL-HPA062351) Datasheet (External Link)
Vendor Page Anti NUCKS1 pAb (ATL-HPA062351)