Anti NUCKS1 pAb (ATL-HPA062351)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062351-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NUCKS1
Alternative Gene Name: NUCKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026434: 98%, ENSRNOG00000047287: 100%
Entrez Gene ID: 64710
Uniprot ID: Q9H1E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG |
| Gene Sequence | MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG |
| Gene ID - Mouse | ENSMUSG00000026434 |
| Gene ID - Rat | ENSRNOG00000047287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUCKS1 pAb (ATL-HPA062351) | |
| Datasheet | Anti NUCKS1 pAb (ATL-HPA062351) Datasheet (External Link) |
| Vendor Page | Anti NUCKS1 pAb (ATL-HPA062351) at Atlas Antibodies |
| Documents & Links for Anti NUCKS1 pAb (ATL-HPA062351) | |
| Datasheet | Anti NUCKS1 pAb (ATL-HPA062351) Datasheet (External Link) |
| Vendor Page | Anti NUCKS1 pAb (ATL-HPA062351) |