Anti NUBPL pAb (ATL-HPA029203)

Atlas Antibodies

Catalog No.:
ATL-HPA029203-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nucleotide binding protein-like
Gene Name: NUBPL
Alternative Gene Name: C14orf127, FLJ12660, huInd1, IND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035142: 91%, ENSRNOG00000027444: 92%
Entrez Gene ID: 80224
Uniprot ID: Q8TB37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRG
Gene Sequence MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRG
Gene ID - Mouse ENSMUSG00000035142
Gene ID - Rat ENSRNOG00000027444
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUBPL pAb (ATL-HPA029203)
Datasheet Anti NUBPL pAb (ATL-HPA029203) Datasheet (External Link)
Vendor Page Anti NUBPL pAb (ATL-HPA029203) at Atlas Antibodies

Documents & Links for Anti NUBPL pAb (ATL-HPA029203)
Datasheet Anti NUBPL pAb (ATL-HPA029203) Datasheet (External Link)
Vendor Page Anti NUBPL pAb (ATL-HPA029203)
Citations for Anti NUBPL pAb (ATL-HPA029203) – 1 Found
Wang, Yuhui; Wu, Nan; Sun, Donglin; Sun, Haiming; Tong, Dandan; Liu, Duo; Pang, Bo; Li, Su; Wei, Jia; Dai, Jialin; Liu, Yang; Bai, Jing; Geng, Jingshu; Fu, Songbin; Jin, Yan. NUBPL, a novel metastasis-related gene, promotes colorectal carcinoma cell motility by inducing epithelial-mesenchymal transition. Cancer Science. 2017;108(6):1169-1176.  PubMed