Anti NUBPL pAb (ATL-HPA029203)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029203-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NUBPL
Alternative Gene Name: C14orf127, FLJ12660, huInd1, IND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035142: 91%, ENSRNOG00000027444: 92%
Entrez Gene ID: 80224
Uniprot ID: Q8TB37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRG |
| Gene Sequence | MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRG |
| Gene ID - Mouse | ENSMUSG00000035142 |
| Gene ID - Rat | ENSRNOG00000027444 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUBPL pAb (ATL-HPA029203) | |
| Datasheet | Anti NUBPL pAb (ATL-HPA029203) Datasheet (External Link) |
| Vendor Page | Anti NUBPL pAb (ATL-HPA029203) at Atlas Antibodies |
| Documents & Links for Anti NUBPL pAb (ATL-HPA029203) | |
| Datasheet | Anti NUBPL pAb (ATL-HPA029203) Datasheet (External Link) |
| Vendor Page | Anti NUBPL pAb (ATL-HPA029203) |
| Citations for Anti NUBPL pAb (ATL-HPA029203) – 1 Found |
| Wang, Yuhui; Wu, Nan; Sun, Donglin; Sun, Haiming; Tong, Dandan; Liu, Duo; Pang, Bo; Li, Su; Wei, Jia; Dai, Jialin; Liu, Yang; Bai, Jing; Geng, Jingshu; Fu, Songbin; Jin, Yan. NUBPL, a novel metastasis-related gene, promotes colorectal carcinoma cell motility by inducing epithelial-mesenchymal transition. Cancer Science. 2017;108(6):1169-1176. PubMed |