Anti NTS pAb (ATL-HPA071012)

Atlas Antibodies

Catalog No.:
ATL-HPA071012-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neurotensin
Gene Name: NTS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019890: 75%, ENSRNOG00000004179: 70%
Entrez Gene ID: 4922
Uniprot ID: P30990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALD
Gene Sequence SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALD
Gene ID - Mouse ENSMUSG00000019890
Gene ID - Rat ENSRNOG00000004179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NTS pAb (ATL-HPA071012)
Datasheet Anti NTS pAb (ATL-HPA071012) Datasheet (External Link)
Vendor Page Anti NTS pAb (ATL-HPA071012) at Atlas Antibodies

Documents & Links for Anti NTS pAb (ATL-HPA071012)
Datasheet Anti NTS pAb (ATL-HPA071012) Datasheet (External Link)
Vendor Page Anti NTS pAb (ATL-HPA071012)