Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035799-25

• 

Protein Description: neurotrophic tyrosine kinase, receptor, type 1
Gene Name: NTRK1
Alternative Gene Name: MTC, TRK, TRKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028072: 82%, ENSRNOG00000013953: 84%
Entrez Gene ID: 4914
Uniprot ID: P04629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG
• Gene Sequence: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG
• Gene ID - Mouse: ENSMUSG00000028072
• Gene ID - Rat: ENSRNOG00000013953
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.