Anti NTNG2 pAb (ATL-HPA071290)

Atlas Antibodies

Catalog No.:
ATL-HPA071290-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: netrin G2
Gene Name: NTNG2
Alternative Gene Name: KIAA1857, Lmnt2, NTNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035513: 89%, ENSRNOG00000013694: 91%
Entrez Gene ID: 84628
Uniprot ID: Q96CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG
Gene Sequence KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG
Gene ID - Mouse ENSMUSG00000035513
Gene ID - Rat ENSRNOG00000013694
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NTNG2 pAb (ATL-HPA071290)
Datasheet Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link)
Vendor Page Anti NTNG2 pAb (ATL-HPA071290) at Atlas Antibodies

Documents & Links for Anti NTNG2 pAb (ATL-HPA071290)
Datasheet Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link)
Vendor Page Anti NTNG2 pAb (ATL-HPA071290)