Anti NTNG2 pAb (ATL-HPA071290)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071290-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NTNG2
Alternative Gene Name: KIAA1857, Lmnt2, NTNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035513: 89%, ENSRNOG00000013694: 91%
Entrez Gene ID: 84628
Uniprot ID: Q96CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG |
| Gene Sequence | KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG |
| Gene ID - Mouse | ENSMUSG00000035513 |
| Gene ID - Rat | ENSRNOG00000013694 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NTNG2 pAb (ATL-HPA071290) | |
| Datasheet | Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link) |
| Vendor Page | Anti NTNG2 pAb (ATL-HPA071290) at Atlas Antibodies |
| Documents & Links for Anti NTNG2 pAb (ATL-HPA071290) | |
| Datasheet | Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link) |
| Vendor Page | Anti NTNG2 pAb (ATL-HPA071290) |