Anti NTMT1 pAb (ATL-HPA058420)

Atlas Antibodies

Catalog No.:
ATL-HPA058420-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: N-terminal Xaa-Pro-Lys N-methyltransferase 1
Gene Name: NTMT1
Alternative Gene Name: AD-003, C9orf32, HOMT1A, METTL11A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026857: 97%, ENSRNOG00000024809: 97%
Entrez Gene ID: 28989
Uniprot ID: Q9BV86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Gene Sequence MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Gene ID - Mouse ENSMUSG00000026857
Gene ID - Rat ENSRNOG00000024809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NTMT1 pAb (ATL-HPA058420)
Datasheet Anti NTMT1 pAb (ATL-HPA058420) Datasheet (External Link)
Vendor Page Anti NTMT1 pAb (ATL-HPA058420) at Atlas Antibodies

Documents & Links for Anti NTMT1 pAb (ATL-HPA058420)
Datasheet Anti NTMT1 pAb (ATL-HPA058420) Datasheet (External Link)
Vendor Page Anti NTMT1 pAb (ATL-HPA058420)