Anti NT5DC4 pAb (ATL-HPA046856)

Atlas Antibodies

Catalog No.:
ATL-HPA046856-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase domain containing 4
Gene Name: NT5DC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039126: 29%, ENSRNOG00000021091: 28%
Entrez Gene ID:
Uniprot ID: Q86YG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQANLDPASCLLSCNQRSLPAKSCLSSAI
Gene Sequence RLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQANLDPASCLLSCNQRSLPAKSCLSSAI
Gene ID - Mouse ENSMUSG00000039126
Gene ID - Rat ENSRNOG00000021091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NT5DC4 pAb (ATL-HPA046856)
Datasheet Anti NT5DC4 pAb (ATL-HPA046856) Datasheet (External Link)
Vendor Page Anti NT5DC4 pAb (ATL-HPA046856) at Atlas Antibodies

Documents & Links for Anti NT5DC4 pAb (ATL-HPA046856)
Datasheet Anti NT5DC4 pAb (ATL-HPA046856) Datasheet (External Link)
Vendor Page Anti NT5DC4 pAb (ATL-HPA046856)