Anti NT5DC2 pAb (ATL-HPA050683)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050683-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NT5DC2
Alternative Gene Name: FLJ12442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071547: 97%, ENSRNOG00000018358: 97%
Entrez Gene ID: 64943
Uniprot ID: Q9H857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLV |
| Gene Sequence | LSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLV |
| Gene ID - Mouse | ENSMUSG00000071547 |
| Gene ID - Rat | ENSRNOG00000018358 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NT5DC2 pAb (ATL-HPA050683) | |
| Datasheet | Anti NT5DC2 pAb (ATL-HPA050683) Datasheet (External Link) |
| Vendor Page | Anti NT5DC2 pAb (ATL-HPA050683) at Atlas Antibodies |
| Documents & Links for Anti NT5DC2 pAb (ATL-HPA050683) | |
| Datasheet | Anti NT5DC2 pAb (ATL-HPA050683) Datasheet (External Link) |
| Vendor Page | Anti NT5DC2 pAb (ATL-HPA050683) |
| Citations for Anti NT5DC2 pAb (ATL-HPA050683) – 1 Found |
| Schulze, Arik Bernard; Kuntze, Anna; Schmidt, Lars Henning; Mohr, Michael; Marra, Alessandro; Hillejan, Ludger; Schulz, Christian; Görlich, Dennis; Hartmann, Wolfgang; Bleckmann, Annalen; Evers, Georg. High Expression of NT5DC2 Is a Negative Prognostic Marker in Pulmonary Adenocarcinoma. Cancers. 2022;14(6) PubMed |