Anti NT5DC2 pAb (ATL-HPA050683)

Atlas Antibodies

Catalog No.:
ATL-HPA050683-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase domain containing 2
Gene Name: NT5DC2
Alternative Gene Name: FLJ12442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071547: 97%, ENSRNOG00000018358: 97%
Entrez Gene ID: 64943
Uniprot ID: Q9H857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLV
Gene Sequence LSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLV
Gene ID - Mouse ENSMUSG00000071547
Gene ID - Rat ENSRNOG00000018358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NT5DC2 pAb (ATL-HPA050683)
Datasheet Anti NT5DC2 pAb (ATL-HPA050683) Datasheet (External Link)
Vendor Page Anti NT5DC2 pAb (ATL-HPA050683) at Atlas Antibodies

Documents & Links for Anti NT5DC2 pAb (ATL-HPA050683)
Datasheet Anti NT5DC2 pAb (ATL-HPA050683) Datasheet (External Link)
Vendor Page Anti NT5DC2 pAb (ATL-HPA050683)
Citations for Anti NT5DC2 pAb (ATL-HPA050683) – 1 Found
Schulze, Arik Bernard; Kuntze, Anna; Schmidt, Lars Henning; Mohr, Michael; Marra, Alessandro; Hillejan, Ludger; Schulz, Christian; Görlich, Dennis; Hartmann, Wolfgang; Bleckmann, Annalen; Evers, Georg. High Expression of NT5DC2 Is a Negative Prognostic Marker in Pulmonary Adenocarcinoma. Cancers. 2022;14(6)  PubMed