Anti NT5C3B pAb (ATL-HPA057095)

Atlas Antibodies

Catalog No.:
ATL-HPA057095-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase, cytosolic IIIB
Gene Name: NT5C3B
Alternative Gene Name: MGC20781, NT5C3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017176: 87%, ENSRNOG00000016475: 87%
Entrez Gene ID: 115024
Uniprot ID: Q969T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
Gene Sequence IVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQLEGKTNVILLGDSIG
Gene ID - Mouse ENSMUSG00000017176
Gene ID - Rat ENSRNOG00000016475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NT5C3B pAb (ATL-HPA057095)
Datasheet Anti NT5C3B pAb (ATL-HPA057095) Datasheet (External Link)
Vendor Page Anti NT5C3B pAb (ATL-HPA057095) at Atlas Antibodies

Documents & Links for Anti NT5C3B pAb (ATL-HPA057095)
Datasheet Anti NT5C3B pAb (ATL-HPA057095) Datasheet (External Link)
Vendor Page Anti NT5C3B pAb (ATL-HPA057095)