Anti NT5C1B pAb (ATL-HPA056683)

Atlas Antibodies

Catalog No.:
ATL-HPA056683-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase, cytosolic IB
Gene Name: NT5C1B
Alternative Gene Name: AIRP, CN-IB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020622: 82%, ENSRNOG00000004296: 77%
Entrez Gene ID: 93034
Uniprot ID: Q96P26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQG
Gene Sequence SQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQG
Gene ID - Mouse ENSMUSG00000020622
Gene ID - Rat ENSRNOG00000004296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NT5C1B pAb (ATL-HPA056683)
Datasheet Anti NT5C1B pAb (ATL-HPA056683) Datasheet (External Link)
Vendor Page Anti NT5C1B pAb (ATL-HPA056683) at Atlas Antibodies

Documents & Links for Anti NT5C1B pAb (ATL-HPA056683)
Datasheet Anti NT5C1B pAb (ATL-HPA056683) Datasheet (External Link)
Vendor Page Anti NT5C1B pAb (ATL-HPA056683)