Anti NT5C1B pAb (ATL-HPA056683)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056683-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NT5C1B
Alternative Gene Name: AIRP, CN-IB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020622: 82%, ENSRNOG00000004296: 77%
Entrez Gene ID: 93034
Uniprot ID: Q96P26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQG |
Gene Sequence | SQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQG |
Gene ID - Mouse | ENSMUSG00000020622 |
Gene ID - Rat | ENSRNOG00000004296 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NT5C1B pAb (ATL-HPA056683) | |
Datasheet | Anti NT5C1B pAb (ATL-HPA056683) Datasheet (External Link) |
Vendor Page | Anti NT5C1B pAb (ATL-HPA056683) at Atlas Antibodies |
Documents & Links for Anti NT5C1B pAb (ATL-HPA056683) | |
Datasheet | Anti NT5C1B pAb (ATL-HPA056683) Datasheet (External Link) |
Vendor Page | Anti NT5C1B pAb (ATL-HPA056683) |