Anti NT5C1A pAb (ATL-HPA054158)

Atlas Antibodies

SKU:
ATL-HPA054158-25
  • Immunohistochemical staining of human heart muscle shows cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase, cytosolic IA
Gene Name: NT5C1A
Alternative Gene Name: CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054958: 89%, ENSRNOG00000015283: 78%
Entrez Gene ID: 84618
Uniprot ID: Q9BXI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA
Gene Sequence DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA
Gene ID - Mouse ENSMUSG00000054958
Gene ID - Rat ENSRNOG00000015283
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NT5C1A pAb (ATL-HPA054158)
Datasheet Anti NT5C1A pAb (ATL-HPA054158) Datasheet (External Link)
Vendor Page Anti NT5C1A pAb (ATL-HPA054158) at Atlas Antibodies

Documents & Links for Anti NT5C1A pAb (ATL-HPA054158)
Datasheet Anti NT5C1A pAb (ATL-HPA054158) Datasheet (External Link)
Vendor Page Anti NT5C1A pAb (ATL-HPA054158)