Anti NT5C1A pAb (ATL-HPA054158)

Atlas Antibodies

SKU: ATL-HPA054158-25

• 

Protein Description: 5'-nucleotidase, cytosolic IA
Gene Name: NT5C1A
Alternative Gene Name: CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054958: 89%, ENSRNOG00000015283: 78%
Entrez Gene ID: 84618
Uniprot ID: Q9BXI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA
• Gene Sequence: DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA
• Gene ID - Mouse: ENSMUSG00000054958
• Gene ID - Rat: ENSRNOG00000015283
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.