Anti NT5C pAb (ATL-HPA021581)

Atlas Antibodies

Catalog No.: ATL-HPA021581-100

Protein Description: 5', 3'-nucleotidase, cytosolic
Gene Name: NT5C
Alternative Gene Name: cdN, DNT-1, DNT1, PN-I, UMPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020736: 85%, ENSRNOG00000003650: 83%
Entrez Gene ID: 30833
Uniprot ID: Q8TCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
• Gene Sequence: GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
• Gene ID - Mouse: ENSMUSG00000020736
• Gene ID - Rat: ENSRNOG00000003650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.