Anti NSMCE2 pAb (ATL-HPA051614)

Atlas Antibodies

Catalog No.:
ATL-HPA051614-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase
Gene Name: NSMCE2
Alternative Gene Name: C8orf36, FLJ32440, MMS21, NSE2, ZMIZ7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059586: 84%, ENSRNOG00000003964: 84%
Entrez Gene ID: 286053
Uniprot ID: Q96MF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Gene Sequence SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Gene ID - Mouse ENSMUSG00000059586
Gene ID - Rat ENSRNOG00000003964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NSMCE2 pAb (ATL-HPA051614)
Datasheet Anti NSMCE2 pAb (ATL-HPA051614) Datasheet (External Link)
Vendor Page Anti NSMCE2 pAb (ATL-HPA051614) at Atlas Antibodies

Documents & Links for Anti NSMCE2 pAb (ATL-HPA051614)
Datasheet Anti NSMCE2 pAb (ATL-HPA051614) Datasheet (External Link)
Vendor Page Anti NSMCE2 pAb (ATL-HPA051614)