Anti NRSN1 pAb (ATL-HPA061006)

Atlas Antibodies

Catalog No.:
ATL-HPA061006-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neurensin 1
Gene Name: NRSN1
Alternative Gene Name: p24, VMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048978: 93%, ENSRNOG00000017444: 91%
Entrez Gene ID: 140767
Uniprot ID: Q8IZ57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT
Gene Sequence VKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT
Gene ID - Mouse ENSMUSG00000048978
Gene ID - Rat ENSRNOG00000017444
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NRSN1 pAb (ATL-HPA061006)
Datasheet Anti NRSN1 pAb (ATL-HPA061006) Datasheet (External Link)
Vendor Page Anti NRSN1 pAb (ATL-HPA061006) at Atlas Antibodies

Documents & Links for Anti NRSN1 pAb (ATL-HPA061006)
Datasheet Anti NRSN1 pAb (ATL-HPA061006) Datasheet (External Link)
Vendor Page Anti NRSN1 pAb (ATL-HPA061006)