Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054974-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: NRP2
Alternative Gene Name: VEGF165R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025969: 85%, ENSRNOG00000031232: 83%
Entrez Gene ID: 8828
Uniprot ID: O60462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY |
| Gene Sequence | PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY |
| Gene ID - Mouse | ENSMUSG00000025969 |
| Gene ID - Rat | ENSRNOG00000031232 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) | |
| Datasheet | Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) | |
| Datasheet | Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) |
| Citations for Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) – 1 Found |
| Plant, Tracie; Eamsamarng, Suttida; Sanchez-Garcia, Manuel A; Reyes, Leila; Renshaw, Stephen A; Coelho, Patricia; Mirchandani, Ananda S; Morgan, Jessie-May; Ellett, Felix E; Morrison, Tyler; Humphries, Duncan; Watts, Emily R; Murphy, Fiona; Raffo-Iraolagoitia, Ximena L; Zhang, Ailiang; Cash, Jenna L; Loynes, Catherine; Elks, Philip M; Van Eeden, Freek; Carlin, Leo M; Furley, Andrew Jw; Whyte, Moira Kb; Walmsley, Sarah R. Semaphorin 3F signaling actively retains neutrophils at sites of inflammation. The Journal Of Clinical Investigation. 2020;130(6):3221-3237. PubMed |