Anti NRIP3 pAb (ATL-HPA058827)

Atlas Antibodies

Catalog No.: ATL-HPA058827-25

Protein Description: nuclear receptor interacting protein 3
Gene Name: NRIP3
Alternative Gene Name: C11orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034825: 91%, ENSRNOG00000013290: 90%
Entrez Gene ID: 56675
Uniprot ID: Q9NQ35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQT
• Gene Sequence: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQT
• Gene ID - Mouse: ENSMUSG00000034825
• Gene ID - Rat: ENSRNOG00000013290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.