Anti NRG4 pAb (ATL-HPA010957)

Atlas Antibodies

Catalog No.:
ATL-HPA010957-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neuregulin 4
Gene Name: NRG4
Alternative Gene Name: HRG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032311: 84%, ENSRNOG00000015149: 88%
Entrez Gene ID: 145957
Uniprot ID: Q8WWG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
Gene Sequence MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
Gene ID - Mouse ENSMUSG00000032311
Gene ID - Rat ENSRNOG00000015149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NRG4 pAb (ATL-HPA010957)
Datasheet Anti NRG4 pAb (ATL-HPA010957) Datasheet (External Link)
Vendor Page Anti NRG4 pAb (ATL-HPA010957) at Atlas Antibodies

Documents & Links for Anti NRG4 pAb (ATL-HPA010957)
Datasheet Anti NRG4 pAb (ATL-HPA010957) Datasheet (External Link)
Vendor Page Anti NRG4 pAb (ATL-HPA010957)