Anti NREP pAb (ATL-HPA000545)

Atlas Antibodies

Catalog No.: ATL-HPA000545-25

Protein Description: neuronal regeneration related protein
Gene Name: NREP
Alternative Gene Name: C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042834: 78%, ENSRNOG00000020467: 76%
Entrez Gene ID: 9315
Uniprot ID: Q16612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
• Gene Sequence: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
• Gene ID - Mouse: ENSMUSG00000042834
• Gene ID - Rat: ENSRNOG00000020467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NREP pAb (ATL-HPA000545) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.