Anti NRDC pAb (ATL-HPA053661)

Atlas Antibodies

Catalog No.:
ATL-HPA053661-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nardilysin convertase
Gene Name: NRDC
Alternative Gene Name: hNRD1, hNRD2, NRD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053510: 82%, ENSRNOG00000007111: 80%
Entrez Gene ID: 4898
Uniprot ID: O43847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT
Gene Sequence LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT
Gene ID - Mouse ENSMUSG00000053510
Gene ID - Rat ENSRNOG00000007111
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NRDC pAb (ATL-HPA053661)
Datasheet Anti NRDC pAb (ATL-HPA053661) Datasheet (External Link)
Vendor Page Anti NRDC pAb (ATL-HPA053661) at Atlas Antibodies

Documents & Links for Anti NRDC pAb (ATL-HPA053661)
Datasheet Anti NRDC pAb (ATL-HPA053661) Datasheet (External Link)
Vendor Page Anti NRDC pAb (ATL-HPA053661)