Anti NRBF2 pAb (ATL-HPA059477)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059477-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NRBF2
Alternative Gene Name: COPR1, COPR2, DKFZp564C1664, FLJ30395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075000: 93%, ENSRNOG00000000641: 97%
Entrez Gene ID: 29982
Uniprot ID: Q96F24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT |
| Gene Sequence | MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT |
| Gene ID - Mouse | ENSMUSG00000075000 |
| Gene ID - Rat | ENSRNOG00000000641 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NRBF2 pAb (ATL-HPA059477) | |
| Datasheet | Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link) |
| Vendor Page | Anti NRBF2 pAb (ATL-HPA059477) at Atlas Antibodies |
| Documents & Links for Anti NRBF2 pAb (ATL-HPA059477) | |
| Datasheet | Anti NRBF2 pAb (ATL-HPA059477) Datasheet (External Link) |
| Vendor Page | Anti NRBF2 pAb (ATL-HPA059477) |