Anti NRBF2 pAb (ATL-HPA059477)

Atlas Antibodies

SKU: ATL-HPA059477-100

• 
• 

Protein Description: nuclear receptor binding factor 2
Gene Name: NRBF2
Alternative Gene Name: COPR1, COPR2, DKFZp564C1664, FLJ30395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075000: 93%, ENSRNOG00000000641: 97%
Entrez Gene ID: 29982
Uniprot ID: Q96F24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
• Gene Sequence: MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT
• Gene ID - Mouse: ENSMUSG00000075000
• Gene ID - Rat: ENSRNOG00000000641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.