Anti NRBF2 pAb (ATL-HPA021670)

Atlas Antibodies

Catalog No.: ATL-HPA021670-25

Protein Description: nuclear receptor binding factor 2
Gene Name: NRBF2
Alternative Gene Name: COPR1, COPR2, DKFZp564C1664, FLJ30395
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075000: 94%, ENSRNOG00000000641: 95%
Entrez Gene ID: 29982
Uniprot ID: Q96F24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFM
• Gene Sequence: PCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFM
• Gene ID - Mouse: ENSMUSG00000075000
• Gene ID - Rat: ENSRNOG00000000641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NRBF2 pAb (ATL-HPA021670) – 1 Found

Wu, Ming-Yue; Liu, Le; Wang, Er-Jin; Xiao, Hai-Tao; Cai, Cui-Zan; Wang, Jing; Su, Huanxing; Wang, Yitao; Tan, Jieqiong; Zhang, Zhuohua; Wang, Juan; Yao, Maojing; Ouyang, De-Fang; Yue, Zhenyu; Li, Min; Chen, Ye; Bian, Zhao-Xiang; Lu, Jia-Hong. PI3KC3 complex subunit NRBF2 is required for apoptotic cell clearance to restrict intestinal inflammation. Autophagy. 2021;17(5):1096-1111.