Anti NR4A1 pAb (ATL-HPA070142)

Atlas Antibodies

Catalog No.:
ATL-HPA070142-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 4 group A member 1
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
Gene Sequence PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
Gene ID - Mouse ENSMUSG00000023034
Gene ID - Rat ENSRNOG00000007607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR4A1 pAb (ATL-HPA070142)
Datasheet Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link)
Vendor Page Anti NR4A1 pAb (ATL-HPA070142) at Atlas Antibodies

Documents & Links for Anti NR4A1 pAb (ATL-HPA070142)
Datasheet Anti NR4A1 pAb (ATL-HPA070142) Datasheet (External Link)
Vendor Page Anti NR4A1 pAb (ATL-HPA070142)