Anti NR4A1 pAb (ATL-HPA070142)

Atlas Antibodies

SKU: ATL-HPA070142-25

• 

Protein Description: nuclear receptor subfamily 4 group A member 1
Gene Name: NR4A1
Alternative Gene Name: GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023034: 94%, ENSRNOG00000007607: 92%
Entrez Gene ID: 3164
Uniprot ID: P22736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
• Gene Sequence: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
• Gene ID - Mouse: ENSMUSG00000023034
• Gene ID - Rat: ENSRNOG00000007607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.