Anti NR3C2 pAb (ATL-HPA074979)

Atlas Antibodies

Catalog No.: ATL-HPA074979-25

Protein Description: nuclear receptor subfamily 3, group C, member 2
Gene Name: NR3C2
Alternative Gene Name: MLR, MR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031618: 95%, ENSRNOG00000034007: 98%
Entrez Gene ID: 4306
Uniprot ID: P08235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL
• Gene Sequence: PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL
• Gene ID - Mouse: ENSMUSG00000031618
• Gene ID - Rat: ENSRNOG00000034007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.