Anti NR3C2 pAb (ATL-HPA074979)

Atlas Antibodies

Catalog No.:
ATL-HPA074979-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 3, group C, member 2
Gene Name: NR3C2
Alternative Gene Name: MLR, MR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031618: 95%, ENSRNOG00000034007: 98%
Entrez Gene ID: 4306
Uniprot ID: P08235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL
Gene Sequence PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL
Gene ID - Mouse ENSMUSG00000031618
Gene ID - Rat ENSRNOG00000034007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR3C2 pAb (ATL-HPA074979)
Datasheet Anti NR3C2 pAb (ATL-HPA074979) Datasheet (External Link)
Vendor Page Anti NR3C2 pAb (ATL-HPA074979) at Atlas Antibodies

Documents & Links for Anti NR3C2 pAb (ATL-HPA074979)
Datasheet Anti NR3C2 pAb (ATL-HPA074979) Datasheet (External Link)
Vendor Page Anti NR3C2 pAb (ATL-HPA074979)