Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004248-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Gene Name: NR3C1
Alternative Gene Name: GR, GRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024431: 72%, ENSRNOG00000048800: 71%
Entrez Gene ID: 2908
Uniprot ID: P04150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Gene Sequence DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Gene ID - Mouse ENSMUSG00000024431
Gene ID - Rat ENSRNOG00000048800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation)
Datasheet Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation)
Datasheet Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation)
Citations for Anti NR3C1 pAb (ATL-HPA004248 w/enhanced validation) – 4 Found
Kim, Kang Ho; Lee, Jae Man; Zhou, Ying; Harpavat, Sanjiv; Moore, David D. Glucocorticoids Have Opposing Effects on Liver Fibrosis in Hepatic Stellate and Immune Cells. Molecular Endocrinology (Baltimore, Md.). 2016;30(8):905-16.  PubMed
Zheng, Gen; Victor Fon, Gordon; Meixner, Walter; Creekmore, Amy; Zong, Ye; K Dame, Michael; Colacino, Justin; Dedhia, Priya H; Hong, Shuangsong; Wiley, John W. Chronic stress and intestinal barrier dysfunction: Glucocorticoid receptor and transcription repressor HES1 regulate tight junction protein Claudin-1 promoter. Scientific Reports. 2017;7(1):4502.  PubMed
Welter, Harald; Herrmann, Carola; Dellweg, Nils; Missel, Annika; Thanisch, Christiane; Urbanski, Henryk F; Köhn, Frank-Michael; Schwarzer, J Ullrich; Müller-Taubenberger, Annette; Mayerhofer, Artur. The Glucocorticoid Receptor NR3C1 in Testicular Peritubular Cells is Developmentally Regulated and Linked to the Smooth Muscle-Like Cellular Phenotype. Journal Of Clinical Medicine. 2020;9(4)  PubMed
Fennell, K A; Busby, R G G; Li, S; Bodden, C; Stanger, S J; Nixon, B; Short, A K; Hannan, A J; Pang, T Y. Limitations to intergenerational inheritance: subchronic paternal stress preconception does not influence offspring anxiety. Scientific Reports. 2020;10(1):16050.  PubMed