Anti NR2C1 pAb (ATL-HPA035040)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035040-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NR2C1
Alternative Gene Name: TR2, TR2-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005897: 73%, ENSRNOG00000006983: 72%
Entrez Gene ID: 7181
Uniprot ID: P13056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV |
| Gene Sequence | QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV |
| Gene ID - Mouse | ENSMUSG00000005897 |
| Gene ID - Rat | ENSRNOG00000006983 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NR2C1 pAb (ATL-HPA035040) | |
| Datasheet | Anti NR2C1 pAb (ATL-HPA035040) Datasheet (External Link) |
| Vendor Page | Anti NR2C1 pAb (ATL-HPA035040) at Atlas Antibodies |
| Documents & Links for Anti NR2C1 pAb (ATL-HPA035040) | |
| Datasheet | Anti NR2C1 pAb (ATL-HPA035040) Datasheet (External Link) |
| Vendor Page | Anti NR2C1 pAb (ATL-HPA035040) |