Anti NR1I2 pAb (ATL-HPA055121)

Atlas Antibodies

Catalog No.:
ATL-HPA055121-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 1, group I, member 2
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023345: 26%, ENSRNOG00000007916: 31%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
Gene Sequence RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
Gene ID - Mouse ENSMUSG00000023345
Gene ID - Rat ENSRNOG00000007916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR1I2 pAb (ATL-HPA055121)
Datasheet Anti NR1I2 pAb (ATL-HPA055121) Datasheet (External Link)
Vendor Page Anti NR1I2 pAb (ATL-HPA055121) at Atlas Antibodies

Documents & Links for Anti NR1I2 pAb (ATL-HPA055121)
Datasheet Anti NR1I2 pAb (ATL-HPA055121) Datasheet (External Link)
Vendor Page Anti NR1I2 pAb (ATL-HPA055121)