Anti NR1D2 pAb (ATL-HPA054798)

Atlas Antibodies

Catalog No.:
ATL-HPA054798-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 1, group D, member 2
Gene Name: NR1D2
Alternative Gene Name: BD73, EAR-1r, Hs.37288, HZF2, RVR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021775: 82%, ENSRNOG00000046912: 81%
Entrez Gene ID: 9975
Uniprot ID: Q14995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKN
Gene Sequence SAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKN
Gene ID - Mouse ENSMUSG00000021775
Gene ID - Rat ENSRNOG00000046912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR1D2 pAb (ATL-HPA054798)
Datasheet Anti NR1D2 pAb (ATL-HPA054798) Datasheet (External Link)
Vendor Page Anti NR1D2 pAb (ATL-HPA054798) at Atlas Antibodies

Documents & Links for Anti NR1D2 pAb (ATL-HPA054798)
Datasheet Anti NR1D2 pAb (ATL-HPA054798) Datasheet (External Link)
Vendor Page Anti NR1D2 pAb (ATL-HPA054798)
Citations for Anti NR1D2 pAb (ATL-HPA054798) – 1 Found
Tang, Mengling; Hu, Zhiqiang; Rao, Chenglong; Chen, Jiangao; Yuan, Siqi; Zhang, Jiangang; Mao, Chan; Yan, Jingmin; Xia, Yupei; Zhang, Meijuan; Yue, Juanjuan; Xiang, Yang; Xie, Jianping; Mao, Xuhu; Li, Qian. Burkholderia pseudomallei interferes with host lipid metabolism via NR1D2-mediated PNPLA2/ATGL suppression to block autophagy-dependent inhibition of infection. Autophagy. 2021;17(8):1918-1933.  PubMed