Anti NR1D2 pAb (ATL-HPA053868)

Atlas Antibodies

Catalog No.:
ATL-HPA053868-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 1, group D, member 2
Gene Name: NR1D2
Alternative Gene Name: BD73, EAR-1r, Hs.37288, HZF2, RVR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021775: 85%, ENSRNOG00000046912: 79%
Entrez Gene ID: 9975
Uniprot ID: Q14995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP
Gene Sequence SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP
Gene ID - Mouse ENSMUSG00000021775
Gene ID - Rat ENSRNOG00000046912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR1D2 pAb (ATL-HPA053868)
Datasheet Anti NR1D2 pAb (ATL-HPA053868) Datasheet (External Link)
Vendor Page Anti NR1D2 pAb (ATL-HPA053868) at Atlas Antibodies

Documents & Links for Anti NR1D2 pAb (ATL-HPA053868)
Datasheet Anti NR1D2 pAb (ATL-HPA053868) Datasheet (External Link)
Vendor Page Anti NR1D2 pAb (ATL-HPA053868)