Anti NR0B1 pAb (ATL-HPA067207)

Atlas Antibodies

SKU: ATL-HPA067207-25

• 

Protein Description: nuclear receptor subfamily 0 group B member 1
Gene Name: NR0B1
Alternative Gene Name: AHC, AHCH, DAX1, DSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025056: 79%, ENSRNOG00000003765: 80%
Entrez Gene ID: 190
Uniprot ID: P51843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT
• Gene Sequence: LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT
• Gene ID - Mouse: ENSMUSG00000025056
• Gene ID - Rat: ENSRNOG00000003765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.