Anti NR0B1 pAb (ATL-HPA061948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061948-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NR0B1
Alternative Gene Name: AHC, AHCH, DAX1, DSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025056: 64%, ENSRNOG00000003765: 61%
Entrez Gene ID: 190
Uniprot ID: P51843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF |
| Gene Sequence | GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF |
| Gene ID - Mouse | ENSMUSG00000025056 |
| Gene ID - Rat | ENSRNOG00000003765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NR0B1 pAb (ATL-HPA061948) | |
| Datasheet | Anti NR0B1 pAb (ATL-HPA061948) Datasheet (External Link) |
| Vendor Page | Anti NR0B1 pAb (ATL-HPA061948) at Atlas Antibodies |
| Documents & Links for Anti NR0B1 pAb (ATL-HPA061948) | |
| Datasheet | Anti NR0B1 pAb (ATL-HPA061948) Datasheet (External Link) |
| Vendor Page | Anti NR0B1 pAb (ATL-HPA061948) |