Anti NPW pAb (ATL-HPA064874)

Atlas Antibodies

Catalog No.:
ATL-HPA064874-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neuropeptide W
Gene Name: NPW
Alternative Gene Name: PPL8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071230: 37%, ENSRNOG00000012390: 41%
Entrez Gene ID: 283869
Uniprot ID: Q8N729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR
Gene Sequence REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR
Gene ID - Mouse ENSMUSG00000071230
Gene ID - Rat ENSRNOG00000012390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NPW pAb (ATL-HPA064874)
Datasheet Anti NPW pAb (ATL-HPA064874) Datasheet (External Link)
Vendor Page Anti NPW pAb (ATL-HPA064874) at Atlas Antibodies

Documents & Links for Anti NPW pAb (ATL-HPA064874)
Datasheet Anti NPW pAb (ATL-HPA064874) Datasheet (External Link)
Vendor Page Anti NPW pAb (ATL-HPA064874)