Anti NPTX2 pAb (ATL-HPA049799)

Atlas Antibodies

Catalog No.:
ATL-HPA049799-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neuronal pentraxin II
Gene Name: NPTX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059991: 98%, ENSRNOG00000001006: 98%
Entrez Gene ID: 4885
Uniprot ID: P47972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL
Gene Sequence LSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL
Gene ID - Mouse ENSMUSG00000059991
Gene ID - Rat ENSRNOG00000001006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NPTX2 pAb (ATL-HPA049799)
Datasheet Anti NPTX2 pAb (ATL-HPA049799) Datasheet (External Link)
Vendor Page Anti NPTX2 pAb (ATL-HPA049799) at Atlas Antibodies

Documents & Links for Anti NPTX2 pAb (ATL-HPA049799)
Datasheet Anti NPTX2 pAb (ATL-HPA049799) Datasheet (External Link)
Vendor Page Anti NPTX2 pAb (ATL-HPA049799)
Citations for Anti NPTX2 pAb (ATL-HPA049799) – 1 Found
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79.  PubMed