Anti NPNT pAb (ATL-HPA003711)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003711-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NPNT
Alternative Gene Name: EGFL6L, POEM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040998: 83%, ENSRNOG00000052873: 54%
Entrez Gene ID: 255743
Uniprot ID: Q6UXI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK |
| Gene Sequence | RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK |
| Gene ID - Mouse | ENSMUSG00000040998 |
| Gene ID - Rat | ENSRNOG00000052873 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NPNT pAb (ATL-HPA003711) | |
| Datasheet | Anti NPNT pAb (ATL-HPA003711) Datasheet (External Link) |
| Vendor Page | Anti NPNT pAb (ATL-HPA003711) at Atlas Antibodies |
| Documents & Links for Anti NPNT pAb (ATL-HPA003711) | |
| Datasheet | Anti NPNT pAb (ATL-HPA003711) Datasheet (External Link) |
| Vendor Page | Anti NPNT pAb (ATL-HPA003711) |
| Citations for Anti NPNT pAb (ATL-HPA003711) – 3 Found |
| Teo, Ada Ee Der; Garg, Sumedha; Johnson, Timothy Isaac; Zhao, Wanfeng; Zhou, Junhua; Gomez-Sanchez, Celso Enrique; Gurnell, Mark; Brown, Morris Jonathan. Physiological and Pathological Roles in Human Adrenal of the Glomeruli-Defining Matrix Protein NPNT (Nephronectin). Hypertension (Dallas, Tex. : 1979). 2017;69(6):1207-1216. PubMed |
| Steigedal, Tonje S; Toraskar, Jimita; Redvers, Richard P; Valla, Marit; Magnussen, Synnøve N; Bofin, Anna M; Opdahl, Signe; Lundgren, Steinar; Eckhardt, Bedrich L; Lamar, John M; Doherty, Judy; Hynes, Richard O; Anderson, Robin L; Svineng, Gunbjørg. Nephronectin is Correlated with Poor Prognosis in Breast Cancer and Promotes Metastasis via its Integrin-Binding Motifs. Neoplasia (New York, N.y.). 2018;20(4):387-400. PubMed |
| Magnussen, Synnøve Norvoll; Toraskar, Jimita; Wilhelm, Imola; Hasko, Janos; Figenschau, Stine Linn; Molnar, Judit; Seppola, Marit; Steigen, Sonja E; Steigedal, Tonje S; Hadler-Olsen, Elin; Krizbai, Istvan A; Svineng, Gunbjørg. Nephronectin promotes breast cancer brain metastatic colonization via its integrin-binding domains. Scientific Reports. 2020;10(1):12237. PubMed |