Anti NPNT pAb (ATL-HPA003711)

Atlas Antibodies

Catalog No.: ATL-HPA003711-25

Protein Description: nephronectin
Gene Name: NPNT
Alternative Gene Name: EGFL6L, POEM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040998: 83%, ENSRNOG00000052873: 54%
Entrez Gene ID: 255743
Uniprot ID: Q6UXI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
• Gene Sequence: RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
• Gene ID - Mouse: ENSMUSG00000040998
• Gene ID - Rat: ENSRNOG00000052873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPNT pAb (ATL-HPA003711) – 3 Found

Teo, Ada Ee Der; Garg, Sumedha; Johnson, Timothy Isaac; Zhao, Wanfeng; Zhou, Junhua; Gomez-Sanchez, Celso Enrique; Gurnell, Mark; Brown, Morris Jonathan. Physiological and Pathological Roles in Human Adrenal of the Glomeruli-Defining Matrix Protein NPNT (Nephronectin). Hypertension (Dallas, Tex. : 1979). 2017;69(6):1207-1216. 

Steigedal, Tonje S; Toraskar, Jimita; Redvers, Richard P; Valla, Marit; Magnussen, Synnøve N; Bofin, Anna M; Opdahl, Signe; Lundgren, Steinar; Eckhardt, Bedrich L; Lamar, John M; Doherty, Judy; Hynes, Richard O; Anderson, Robin L; Svineng, Gunbjørg. Nephronectin is Correlated with Poor Prognosis in Breast Cancer and Promotes Metastasis via its Integrin-Binding Motifs. Neoplasia (New York, N.y.). 2018;20(4):387-400. 

Magnussen, Synnøve Norvoll; Toraskar, Jimita; Wilhelm, Imola; Hasko, Janos; Figenschau, Stine Linn; Molnar, Judit; Seppola, Marit; Steigen, Sonja E; Steigedal, Tonje S; Hadler-Olsen, Elin; Krizbai, Istvan A; Svineng, Gunbjørg. Nephronectin promotes breast cancer brain metastatic colonization via its integrin-binding domains. Scientific Reports. 2020;10(1):12237.