Anti NPM1 pAb (ATL-HPA011384)

Atlas Antibodies

Catalog No.: ATL-HPA011384-25

Protein Description: nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Gene Name: NPM1
Alternative Gene Name: B23, NPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057113: 86%, ENSRNOG00000004616: 86%
Entrez Gene ID: 4869
Uniprot ID: P06748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRS
• Gene Sequence: VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRS
• Gene ID - Mouse: ENSMUSG00000057113
• Gene ID - Rat: ENSRNOG00000004616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPM1 pAb (ATL-HPA011384) – 4 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Röwer, Claudia; Ziems, Björn; Radtke, Anngret; Schmitt, Oliver; Reimer, Toralf; Koy, Cornelia; Thiesen, Hans-Jürgen; Gerber, Bernd; Glocker, Michael O. Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis. International Journal Of Clinical And Experimental Pathology. 2011;4(5):454-67. 

O'Dwyer, Donna; Ralton, Lynda D; O'Shea, Aisling; Murray, Graeme I. The proteomics of colorectal cancer: identification of a protein signature associated with prognosis. Plos One. 6(11):e27718. 

Ognibene, Marzia; Pezzolo, Annalisa. Roniciclib down-regulates stemness and inhibits cell growth by inducing nucleolar stress in neuroblastoma. Scientific Reports. 2020;10(1):12902.