Anti NPLOC4 pAb (ATL-HPA021560 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021560-25

Protein Description: nuclear protein localization 4 homolog (S. cerevisiae)
Gene Name: NPLOC4
Alternative Gene Name: FLJ20657, KIAA1499, NPL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039703: 99%, ENSRNOG00000036698: 99%
Entrez Gene ID: 55666
Uniprot ID: Q8TAT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
• Gene Sequence: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
• Gene ID - Mouse: ENSMUSG00000039703
• Gene ID - Rat: ENSRNOG00000036698
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPLOC4 pAb (ATL-HPA021560 w/enhanced validation) – 2 Found

Tabata, Keisuke; Arakawa, Masashi; Ishida, Kotaro; Kobayashi, Makiko; Nara, Atsuki; Sugimoto, Takehiro; Okada, Tetsuya; Mori, Kazutoshi; Morita, Eiji. Endoplasmic Reticulum-Associated Degradation Controls Virus Protein Homeostasis, Which Is Required for Flavivirus Propagation. Journal Of Virology. 2021;95(15):e0223420. 

Davis, Emily J; Lachaud, Christophe; Appleton, Paul; Macartney, Thomas J; Näthke, Inke; Rouse, John. DVC1 (C1orf124) recruits the p97 protein segregase to sites of DNA damage. Nature Structural & Molecular Biology. 2012;19(11):1093-100.