Anti NPC1 pAb (ATL-HPA026618)

Atlas Antibodies

Catalog No.: ATL-HPA026618-25

Protein Description: Niemann-Pick disease, type C1
Gene Name: NPC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024413: 83%, ENSRNOG00000012016: 81%
Entrez Gene ID: 4864
Uniprot ID: O15118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVD
• Gene Sequence: VLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVD
• Gene ID - Mouse: ENSMUSG00000024413
• Gene ID - Rat: ENSRNOG00000012016
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPC1 pAb (ATL-HPA026618) – 1 Found

Lund, Rikke R; Leth-Larsen, Rikke; Caterino, Tina Di; Terp, Mikkel G; Nissen, Jeanette; Lænkholm, Anne-Vibeke; Jensen, Ole N; Ditzel, Henrik J. NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer. Molecular & Cellular Proteomics : Mcp. 2015;14(11):2988-99.