Anti NPAT pAb (ATL-HPA045908)

Atlas Antibodies

SKU:
ATL-HPA045908-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear protein, ataxia-telangiectasia locus
Gene Name: NPAT
Alternative Gene Name: E14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033054: 83%, ENSRNOG00000024934: 85%
Entrez Gene ID: 4863
Uniprot ID: Q14207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNNFSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSV
Gene Sequence VNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNNFSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSV
Gene ID - Mouse ENSMUSG00000033054
Gene ID - Rat ENSRNOG00000024934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NPAT pAb (ATL-HPA045908)
Datasheet Anti NPAT pAb (ATL-HPA045908) Datasheet (External Link)
Vendor Page Anti NPAT pAb (ATL-HPA045908) at Atlas Antibodies

Documents & Links for Anti NPAT pAb (ATL-HPA045908)
Datasheet Anti NPAT pAb (ATL-HPA045908) Datasheet (External Link)
Vendor Page Anti NPAT pAb (ATL-HPA045908)