Anti NPAS1 pAb (ATL-HPA072259)

Atlas Antibodies

Catalog No.:
ATL-HPA072259-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neuronal PAS domain protein 1
Gene Name: NPAS1
Alternative Gene Name: bHLHe11, MOP5, PASD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001988: 70%, ENSRNOG00000015376: 70%
Entrez Gene ID: 4861
Uniprot ID: Q99742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV
Gene Sequence VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV
Gene ID - Mouse ENSMUSG00000001988
Gene ID - Rat ENSRNOG00000015376
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NPAS1 pAb (ATL-HPA072259)
Datasheet Anti NPAS1 pAb (ATL-HPA072259) Datasheet (External Link)
Vendor Page Anti NPAS1 pAb (ATL-HPA072259) at Atlas Antibodies

Documents & Links for Anti NPAS1 pAb (ATL-HPA072259)
Datasheet Anti NPAS1 pAb (ATL-HPA072259) Datasheet (External Link)
Vendor Page Anti NPAS1 pAb (ATL-HPA072259)