Anti NPAS1 pAb (ATL-HPA072259)

Atlas Antibodies

Catalog No.: ATL-HPA072259-25

Protein Description: neuronal PAS domain protein 1
Gene Name: NPAS1
Alternative Gene Name: bHLHe11, MOP5, PASD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001988: 70%, ENSRNOG00000015376: 70%
Entrez Gene ID: 4861
Uniprot ID: Q99742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV
• Gene Sequence: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV
• Gene ID - Mouse: ENSMUSG00000001988
• Gene ID - Rat: ENSRNOG00000015376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.